SCOPe 2.08: Domain d1o57d2: 1o57 D:75-276

Lineage for d1o57d2 (1o57 D:75-276)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102540] (3 PDB entries)

8. Domain d1o57d2: 1o57 D:75-276 [92490]
   Other proteins in same PDB: d1o57a1, d1o57b1, d1o57c1, d1o57d1
   complexed with 1pe, 2pe, epe, p6g, pg4, so4

Details for d1o57d2

PDB Entry: 1o57, 2.2 Å

PDB Description: crystal structure of the purine operon repressor of bacillus subtilis

PDB Compounds: (D:) pur operon repressor

SCOPe Domain Sequences for d1o57d2:

Sequence, based on SEQRES records:

>d1o57d2 c.61.1.1 (D:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk
tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst
inmkeksieiqngnflrffkdn

Sequence, based on observed residues (ATOM records):

>d1o57d2 c.61.1.1 (D:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtmslakrsmktgsnv
liiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinmke
ksieiqngnflrffkdn

Timeline for d1o57d2:

• d1o57d2 first appeared in SCOP 1.67
  
• d1o57d2 appears in SCOPe 2.07