PDB entry 1o57

View 1o57 on RCSB PDB site
Description: crystal structure of the purine operon repressor of bacillus subtilis
Class: DNA binding protein
Keywords: purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding, transcription regulation, DNA binding protein
Deposited on 2003-04-20, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o57a1, d1o57a2
  • Chain 'B':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o57b1, d1o57b2
  • Chain 'C':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o57c1, d1o57c2
  • Chain 'D':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o57d1, d1o57d2
  • Heterogens: SO4, EPE, P6G, 2PE, PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o57A (A:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57A (A:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtm
    slakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdey
    mslltlstinmkeksieiqngnflrffkdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o57B (B:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57B (B:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrffk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o57C (C:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57C (C:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrffk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o57D (D:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57D (D:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtm
    slakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdey
    mslltlstinmkeksieiqngnflrffkdn