Lineage for d1o57a2 (1o57 A:75-276)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398986Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 398987Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 398988Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (10 proteins)
  6. 399106Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species)
  7. 399107Species Bacillus subtilis [TaxId:1423] [102540] (2 PDB entries)
  8. 399108Domain d1o57a2: 1o57 A:75-276 [92484]
    Other proteins in same PDB: d1o57a1, d1o57b1, d1o57c1, d1o57d1

Details for d1o57a2

PDB Entry: 1o57 (more details), 2.2 Å

PDB Description: crystal structure of the purine operon repressor of bacillus subtilis

SCOP Domain Sequences for d1o57a2:

Sequence, based on SEQRES records: (download)

>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk
tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst
inmkeksieiqngnflrffkdn

Sequence, based on observed residues (ATOM records): (download)

>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtmslakrsmktgsnv
liiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinmke
ksieiqngnflrffkdn

SCOP Domain Coordinates for d1o57a2:

Click to download the PDB-style file with coordinates for d1o57a2.
(The format of our PDB-style files is described here.)

Timeline for d1o57a2: