SCOPe 2.08: Domain d1njir_: 1nji R:

Lineage for d1njir_ (1nji R:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
   Uniprot P12734

8. Domain d1njir_: 1nji R: [85809]
   Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
   complexed with cd, cl, clm, k, mg, na

Details for d1njir_

PDB Entry: 1nji, 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

PDB Compounds: (R:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d1njir_:

Sequence; same for both SEQRES and ATOM records:

>d1njir_ b.34.5.1 (R:) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1njir_:

• d1njir_ first appeared in SCOP 1.65
  
• d1njir_ appears in SCOPe 2.07