Lineage for d1njij_ (1nji J:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2169032Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2169033Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2169034Protein Ribosomal protein L10e [54688] (2 species)
  7. 2169035Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 2169060Domain d1njij_: 1nji J: [85801]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na

Details for d1njij_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (J:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d1njij_:

Sequence, based on SEQRES records: (download)

>d1njij_ d.41.4.1 (J:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1njij_ d.41.4.1 (J:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOPe Domain Coordinates for d1njij_:

Click to download the PDB-style file with coordinates for d1njij_.
(The format of our PDB-style files is described here.)

Timeline for d1njij_: