![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
![]() | Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) ![]() |
![]() | Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
![]() | Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
![]() | Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries) Uniprot P14121 |
![]() | Domain d1njix_: 1nji X: [85815] Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njiy_, d1njiz_ complexed with cd, cl, clm, k, mg, na has additional subdomain(s) that are not in the common domain |
PDB Entry: 1nji (more details), 3 Å
SCOPe Domain Sequences for d1njix_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njix_ d.59.1.1 (X:) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d1njix_:
![]() Domains from other chains: (mouse over for more information) d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njiy_, d1njiz_ |