SCOPe 2.08: Domain d1njio_: 1nji O:

Lineage for d1njio_ (1nji O:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
   Uniprot P14123

8. Domain d1njio_: 1nji O: [85806]
   Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
   complexed with cd, cl, clm, k, mg, na
   has additional insertions and/or extensions that are not grouped together

Details for d1njio_

PDB Entry: 1nji, 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

PDB Compounds: (O:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d1njio_:

Sequence; same for both SEQRES and ATOM records:

>d1njio_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

Timeline for d1njio_:

• d1njio_ first appeared in SCOP 1.65
  
• d1njio_ appears in SCOPe 2.07