Lineage for d1nji4_ (1nji 4:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036997Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 3037102Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
    automatically mapped to Pfam PF00935
  6. 3037103Protein Ribosomal protein L44e [57837] (1 species)
  7. 3037104Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 3037121Domain d1nji4_: 1nji 4: [85791]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na

Details for d1nji4_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (4:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1nji4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nji4_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1nji4_:

Click to download the PDB-style file with coordinates for d1nji4_.
(The format of our PDB-style files is described here.)

Timeline for d1nji4_: