Lineage for d1njin_ (1nji N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929542Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2929543Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2929655Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
    automatically mapped to Pfam PF00827
  6. 2929656Protein Ribosomal protein L15e [54194] (1 species)
  7. 2929657Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
    Uniprot P60618
  8. 2929674Domain d1njin_: 1nji N: [85805]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na

Details for d1njin_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (N:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d1njin_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njin_ d.12.1.2 (N:) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOPe Domain Coordinates for d1njin_:

Click to download the PDB-style file with coordinates for d1njin_.
(The format of our PDB-style files is described here.)

Timeline for d1njin_: