Lineage for d1k73w_ (1k73 W:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689771Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 2689772Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 2689773Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 2689814Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 2689838Domain d1k73w_: 1k73 W: [84339]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73w_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (W:) ribosomal protein l29

SCOPe Domain Sequences for d1k73w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1k73w_:

Click to download the PDB-style file with coordinates for d1k73w_.
(The format of our PDB-style files is described here.)

Timeline for d1k73w_: