Lineage for d1k73u_ (1k73 U:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046659Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2046660Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 protein domains)
  6. 2046703Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2046743Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
    Uniprot P10972
  8. 2046776Domain d1k73u_: 1k73 U: [84337]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73u_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (U:) ribosomal protein l24

SCOPe Domain Sequences for d1k73u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73u_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d1k73u_:

Click to download the PDB-style file with coordinates for d1k73u_.
(The format of our PDB-style files is described here.)

Timeline for d1k73u_: