Class b: All beta proteins [48724] (180 folds) |
Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) automatically mapped to Pfam PF00238 |
Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
Protein Ribosomal protein L14 [50195] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries) Uniprot P22450 |
Domain d1k73l_: 1k73 L: [84328] Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ complexed with anm, cd, cl, k, mg, na |
PDB Entry: 1k73 (more details), 3.01 Å
SCOPe Domain Sequences for d1k73l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k73l_ b.39.1.1 (L:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]} mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr fgsvasaatmiv
Timeline for d1k73l_:
View in 3D Domains from other chains: (mouse over for more information) d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ |