Lineage for d1k73h_ (1k73 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960097Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2960098Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2960115Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2960123Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2960149Domain d1k73h_: 1k73 H: [84324]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73h_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (H:) ribosomal protein l7ae

SCOPe Domain Sequences for d1k73h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73h_ d.79.3.1 (H:) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOPe Domain Coordinates for d1k73h_:

Click to download the PDB-style file with coordinates for d1k73h_.
(The format of our PDB-style files is described here.)

Timeline for d1k73h_: