Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries) Uniprot P14123 |
Domain d1k73o_: 1k73 O: [84331] Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ complexed with anm, cd, cl, k, mg, na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1k73 (more details), 3.01 Å
SCOPe Domain Sequences for d1k73o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k73o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]} atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll dgdiel
Timeline for d1k73o_:
View in 3D Domains from other chains: (mouse over for more information) d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ |