Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (4 species) |
Species Methanococcus jannaschii [TaxId:2190] [88671] (1 PDB entry) |
Domain d1go3e1: 1go3 E:79-184 [83054] Other proteins in same PDB: d1go3e2, d1go3f_, d1go3m2, d1go3n_ protein/DNA complex; protein/RNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1go3 (more details), 1.75 Å
SCOPe Domain Sequences for d1go3e1:
Sequence, based on SEQRES records: (download)
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Methanococcus jannaschii [TaxId: 2190]} pemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsydpkreaiigketgkvlei gdyvrarivaislkaerkrgskialtmrqpylgklewieeekakkq
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Methanococcus jannaschii [TaxId: 2190]} pemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsydpkaiigketgkvleigd yvrarivaislkaskialtmrqpylgklewieeekakkq
Timeline for d1go3e1:
View in 3D Domains from other chains: (mouse over for more information) d1go3f_, d1go3m1, d1go3m2, d1go3n_ |