![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families) ![]() automatically mapped to Pfam PF03876 |
![]() | Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein) |
![]() | Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (4 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [88801] (1 PDB entry) |
![]() | Domain d1go3m2: 1go3 M:1-78 [83057] Other proteins in same PDB: d1go3e1, d1go3f_, d1go3m1, d1go3n_ protein/DNA complex; protein/RNA complex |
PDB Entry: 1go3 (more details), 1.75 Å
SCOPe Domain Sequences for d1go3m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1go3m2 d.230.1.1 (M:1-78) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Methanococcus jannaschii [TaxId: 2190]} mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv hgdgsayhpvvfetlvyi
Timeline for d1go3m2:
![]() Domains from other chains: (mouse over for more information) d1go3e1, d1go3e2, d1go3f_, d1go3n_ |