Lineage for d1go3e1 (1go3 E:79-184)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297600Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 protein domains)
    barrel, closed; n=5, S=8
  6. 297617Protein C-terminal domain of RNA polymerase II subunit RBP4 (RpoE) [88670] (1 species)
  7. 297618Species Archaeon Methanococcus jannaschii [TaxId:2190] [88671] (1 PDB entry)
  8. 297619Domain d1go3e1: 1go3 E:79-184 [83054]
    Other proteins in same PDB: d1go3e2, d1go3f_, d1go3m2, d1go3n_

Details for d1go3e1

PDB Entry: 1go3 (more details), 1.75 Å

PDB Description: structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex

SCOP Domain Sequences for d1go3e1:

Sequence, based on SEQRES records: (download)

>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP4 (RpoE) {Archaeon Methanococcus jannaschii}
pemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsydpkreaiigketgkvlei
gdyvrarivaislkaerkrgskialtmrqpylgklewieeekakkq

Sequence, based on observed residues (ATOM records): (download)

>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP4 (RpoE) {Archaeon Methanococcus jannaschii}
pemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsydpkaiigketgkvleigd
yvrarivaislkaskialtmrqpylgklewieeekakkq

SCOP Domain Coordinates for d1go3e1:

Click to download the PDB-style file with coordinates for d1go3e1.
(The format of our PDB-style files is described here.)

Timeline for d1go3e1: