Lineage for d1o6zd1 (1o6z D:22-162)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 239087Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 239148Protein Malate dehydrogenase [51849] (11 species)
  7. 239153Species Archaeon Haloarcula marismortui [TaxId:2238] [51855] (5 PDB entries)
  8. 239157Domain d1o6zd1: 1o6z D:22-162 [81113]
    Other proteins in same PDB: d1o6za2, d1o6zb2, d1o6zc2, d1o6zd2
    complexed with cl, nad; mutant

Details for d1o6zd1

PDB Entry: 1o6z (more details), 1.95 Å

PDB Description: 1.95 a resolution structure of (r207s,r292s) mutant of malate dehydrogenase from the halophilic archaeon haloarcula marismortui (holo form)

SCOP Domain Sequences for d1o6zd1:

Sequence, based on SEQRES records: (download)

>d1o6zd1 c.2.1.5 (D:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Sequence, based on observed residues (ATOM records): (download)

>d1o6zd1 c.2.1.5 (D:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
nrhlyeagdrsreqvig

SCOP Domain Coordinates for d1o6zd1:

Click to download the PDB-style file with coordinates for d1o6zd1.
(The format of our PDB-style files is described here.)

Timeline for d1o6zd1: