PDB entry 1o6z

View 1o6z on RCSB PDB site
Description: 1.95 a resolution structure of (r207s,r292s) mutant of malate dehydrogenase from the halophilic archaeon haloarcula marismortui (holo form)
Deposited on 2002-10-22, released 2003-02-06
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-06, with a file datestamp of 2003-02-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19365
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o6zA (A:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvsvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvslgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o6zB (B:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvsvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvslgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6zB (B:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
    nrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfsk
    vsvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdtgevlp
    asvklegefghedtafgvpvslgsngveeivewdlddyeqdlmadaaeklsdqydkis
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o6zC (C:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvsvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvslgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o6zD (D:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvsvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvslgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6zD (D:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
    nrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfsk
    vsvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdtgevlp
    asvklegefghedtafgvpvslgsngveeivewdlddyeqdlmadaaeklsdqydkis