SCOP 1.63: Domain d1o6zc1: 1o6z C:22-162

Lineage for d1o6zc1 (1o6z C:22-162)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)

6. Protein Malate dehydrogenase [51849] (11 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [51855] (5 PDB entries)

8. Domain d1o6zc1: 1o6z C:22-162 [81111]
   Other proteins in same PDB: d1o6za2, d1o6zb2, d1o6zc2, d1o6zd2

Details for d1o6zc1

PDB Entry: 1o6z, 1.95 Å

PDB Description: 1.95 a resolution structure of (r207s,r292s) mutant of malate dehydrogenase from the halophilic archaeon haloarcula marismortui (holo form)

SCOP Domain Sequences for d1o6zc1:

Sequence; same for both SEQRES and ATOM records:

>d1o6zc1 c.2.1.5 (C:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Timeline for d1o6zc1:

• d1o6zc1 is new in SCOP 1.63
  
• d1o6zc1 appears in SCOP 1.65
  
• d1o6zc1 appears in the current release, SCOPe 2.08