Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) |
Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins) automatically mapped to Pfam PF09225 |
Protein Restriction endonuclease PvuII [52997] (1 species) |
Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries) |
Domain d1ni0a1: 1ni0 A:3-157 [80522] Other proteins in same PDB: d1ni0a2, d1ni0b2, d1ni0c2 mutant |
PDB Entry: 1ni0 (more details), 2.5 Å
SCOPe Domain Sequences for d1ni0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni0a1 c.52.1.6 (A:3-157) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]} hpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavdn agqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdlef yydkwerkwysdghkdinnpkipvkyvmehgtkiy
Timeline for d1ni0a1:
View in 3D Domains from other chains: (mouse over for more information) d1ni0b1, d1ni0b2, d1ni0c1, d1ni0c2 |