SCOPe 2.05: Domain d1ni0a_: 1ni0 A:

Lineage for d1ni0a_ (1ni0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
   automatically mapped to Pfam PF09225

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)

8. Domain d1ni0a_: 1ni0 A: [80522]
   mutant

Details for d1ni0a_

PDB Entry: 1ni0, 2.5 Å

PDB Description: structure of the y94f mutant of the restriction endonuclease pvuii

PDB Compounds: (A:) type II restriction enzyme pvuii

SCOPe Domain Sequences for d1ni0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ni0a_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
hpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavdn
agqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdlef
yydkwerkwysdghkdinnpkipvkyvmehgtkiyaa

Timeline for d1ni0a_:

• d1ni0a_ first appeared in SCOP 1.63
  
• d1ni0a_ appears in SCOPe 2.04
  
• d1ni0a_ is called d1ni0a1 in SCOPe 2.06
  
• d1ni0a_ appears in the current release, SCOPe 2.08, called d1ni0a1