PDB entry 1ni0

View 1ni0 on RCSB PDB site
Description: Structure of the Y94F mutant of the restriction endonuclease PvuII
Class: hydrolase
Keywords: Restriction endonuclease, PvuII, Point mutation, HYDROLASE
Deposited on 2002-12-20, released 2003-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Gene: PvuiiR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23657 (Start-156)
      • engineered (93)
      • expression tag (157-158)
    Domains in SCOPe 2.06: d1ni0a1, d1ni0a2
  • Chain 'B':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Gene: PvuiiR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23657 (Start-156)
      • engineered (93)
      • expression tag (157-158)
    Domains in SCOPe 2.06: d1ni0b1, d1ni0b2
  • Chain 'C':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Gene: PvuiiR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23657 (Start-156)
      • engineered (93)
      • expression tag (157-158)
    Domains in SCOPe 2.06: d1ni0c1, d1ni0c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ni0A (A:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni0A (A:)
    hpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavdn
    agqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdlef
    yydkwerkwysdghkdinnpkipvkyvmehgtkiyaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ni0B (B:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni0B (B:)
    hpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavdn
    agqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdlef
    yydkwerkwysdghkdinnpkipvkyvmehgtkiyaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ni0C (C:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni0C (C:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiyaa