SCOPe 2.06: Domain d1ni0c1: 1ni0 C:2-157

Lineage for d1ni0c1 (1ni0 C:2-157)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
   automatically mapped to Pfam PF09225

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)

8. Domain d1ni0c1: 1ni0 C:2-157 [80524]
   Other proteins in same PDB: d1ni0a2, d1ni0b2, d1ni0c2
   mutant

Details for d1ni0c1

PDB Entry: 1ni0, 2.5 Å

PDB Description: structure of the y94f mutant of the restriction endonuclease pvuii

PDB Compounds: (C:) type II restriction enzyme pvuii

SCOPe Domain Sequences for d1ni0c1:

Sequence; same for both SEQRES and ATOM records:

>d1ni0c1 c.52.1.6 (C:2-157) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1ni0c1:

• d1ni0c1 first appeared in SCOP 1.63, called d1ni0c_
  
• d1ni0c1 was called d1ni0c_ in SCOPe 2.05
  
• d1ni0c1 appears in SCOPe 2.07
  
• d1ni0c1 appears in the current release, SCOPe 2.08