Lineage for d1ni0a1 (1ni0 A:3-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882368Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
    automatically mapped to Pfam PF09225
  6. 2882369Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 2882370Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 2882381Domain d1ni0a1: 1ni0 A:3-157 [80522]
    Other proteins in same PDB: d1ni0a2, d1ni0b2, d1ni0c2
    mutant

Details for d1ni0a1

PDB Entry: 1ni0 (more details), 2.5 Å

PDB Description: structure of the y94f mutant of the restriction endonuclease pvuii
PDB Compounds: (A:) type II restriction enzyme pvuii

SCOPe Domain Sequences for d1ni0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni0a1 c.52.1.6 (A:3-157) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
hpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavdn
agqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdlef
yydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOPe Domain Coordinates for d1ni0a1:

Click to download the PDB-style file with coordinates for d1ni0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ni0a1: