![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
![]() | Domain d1n34s_: 1n34 S: [79932] Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34t_, d1n34v_ complexed with zn |
PDB Entry: 1n34 (more details), 3.8 Å
SCOPe Domain Sequences for d1n34s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n34s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1n34s_: