Lineage for d1n34s_ (1n34 S:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186446Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2186447Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2186448Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2186449Protein Ribosomal protein S19 [54572] (2 species)
  7. 2186477Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 2186500Domain d1n34s_: 1n34 S: [79932]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34s_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1n34s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1n34s_:

Click to download the PDB-style file with coordinates for d1n34s_.
(The format of our PDB-style files is described here.)

Timeline for d1n34s_: