Lineage for d1n34l_ (1n34 L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399564Protein Ribosomal protein S12 [50302] (2 species)
  7. 2399591Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
    Uniprot P17293
  8. 2399614Domain d1n34l_: 1n34 L: [79925]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34l_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1n34l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d1n34l_:

Click to download the PDB-style file with coordinates for d1n34l_.
(The format of our PDB-style files is described here.)

Timeline for d1n34l_: