Lineage for d1n34h_ (1n34 H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584796Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2584797Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2584798Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2584799Protein Ribosomal protein S8 [56049] (4 species)
  7. 2584817Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2584848Domain d1n34h_: 1n34 H: [79921]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34h_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1n34h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1n34h_:

Click to download the PDB-style file with coordinates for d1n34h_.
(The format of our PDB-style files is described here.)

Timeline for d1n34h_: