| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
| Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
| Protein Ribosomal protein S18 [46913] (2 species) |
| Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
| Domain d1n34r_: 1n34 R: [79931] Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34s_, d1n34t_, d1n34v_ complexed with zn |
PDB Entry: 1n34 (more details), 3.8 Å
SCOPe Domain Sequences for d1n34r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n34r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk
Timeline for d1n34r_: