Lineage for d1n34e2 (1n34 E:5-73)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256657Fold d.50: dsRBD-like [54767] (3 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 256658Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 256678Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 256679Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
    lacks the N-terminal helix
  7. 256682Species Thermus thermophilus [TaxId:274] [54781] (14 PDB entries)
  8. 256693Domain d1n34e2: 1n34 E:5-73 [79918]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34e2

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position

SCOP Domain Sequences for d1n34e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1n34e2:

Click to download the PDB-style file with coordinates for d1n34e2.
(The format of our PDB-style files is described here.)

Timeline for d1n34e2: