Lineage for d1n34t_ (1n34 T:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211240Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211323Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 211324Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 211325Protein Ribosomal protein S20 [46994] (1 species)
  7. 211326Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries)
  8. 211337Domain d1n34t_: 1n34 T: [79933]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34v_
    complexed with zn

Details for d1n34t_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position

SCOP Domain Sequences for d1n34t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1n34t_:

Click to download the PDB-style file with coordinates for d1n34t_.
(The format of our PDB-style files is described here.)

Timeline for d1n34t_: