PDB entry 1n34

View 1n34 on RCSB PDB site
Description:
Deposited on 2002-10-25, released 2002-11-29
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-29, with a file datestamp of 2002-11-29.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.241
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34c1, d1n34c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34e1, d1n34e2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34f_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34g_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34h_
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34i_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34j_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34k_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34l_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34m_
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34n_
  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34o_
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34p_
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34q_
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34r_
  • Chain 'S':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34s_
  • Chain 'T':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34t_
  • Chain 'V':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n34v_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34B (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34C (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34D (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34E (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34F (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34G (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34H (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34I (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34J (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34K (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34L (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34M (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvag
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34N (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34O (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34P (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34Q (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34R (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34S (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34T (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n34V (V:)
    gkgdrrtrrgkiwrgtygkyrprk