Lineage for d1n34n_ (1n34 N:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271116Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 271117Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) (S)
  5. 271230Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 271231Protein Ribosomal protein S14 [57753] (1 species)
  7. 271232Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries)
  8. 271243Domain d1n34n_: 1n34 N: [79927]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34n_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position

SCOP Domain Sequences for d1n34n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1n34n_:

Click to download the PDB-style file with coordinates for d1n34n_.
(The format of our PDB-style files is described here.)

Timeline for d1n34n_: