| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.3: TBP-associated factors, TAFs [47134] (10 proteins) |
| Protein Nuclear transcription factor Y subunit beta (Nf-Yb3) [81724] (1 species) forms a heterodimer with Nf-Yc2 similar to H2A/H2B |
| Species Human (Homo sapiens) [TaxId:9606] [81725] (1 PDB entry) |
| Domain d1n1ja_: 1n1j A: [79813] Other proteins in same PDB: d1n1jb_ |
PDB Entry: 1n1j (more details), 1.67 Å
SCOP Domain Sequences for d1n1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens)}
iylpianvarimknaipqtgkiakdakecvqecvsefisfitseaserchqekrktinge
dilfamstlgfdsyveplklylqkfre
Timeline for d1n1ja_: