Lineage for d1n1ja_ (1n1j A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699163Protein Nuclear transcription factor Y subunit beta (Nf-Yb3) [81724] (1 species)
    forms a heterodimer with Nf-Yc2 similar to H2A/H2B
  7. 2699164Species Human (Homo sapiens) [TaxId:9606] [81725] (1 PDB entry)
  8. 2699165Domain d1n1ja_: 1n1j A: [79813]
    Other proteins in same PDB: d1n1jb_

Details for d1n1ja_

PDB Entry: 1n1j (more details), 1.67 Å

PDB Description: crystal structure of the nf-yb/nf-yc histone pair
PDB Compounds: (A:) nf-yb

SCOPe Domain Sequences for d1n1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]}
iylpianvarimknaipqtgkiakdakecvqecvsefisfitseaserchqekrktinge
dilfamstlgfdsyveplklylqkfre

SCOPe Domain Coordinates for d1n1ja_:

Click to download the PDB-style file with coordinates for d1n1ja_.
(The format of our PDB-style files is described here.)

Timeline for d1n1ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n1jb_