PDB entry 1n1j

View 1n1j on RCSB PDB site
Description: crystal structure of the nf-yb/nf-yc histone pair
Deposited on 2002-10-18, released 2003-02-18
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.181
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n1ja_
  • Chain 'B':
    Domains in SCOP 1.63: d1n1jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n1jA (A:)
iylpianvarimknaipqtgkiakdakecvqecvsefisfitseaserchqekrktinge
dilfamstlgfdsyveplklylqkfre

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n1jB (B:)
lplarikkimkldedvkmisaeapvlfakaaqifiteltlrawihtednkrrtlqrndia
maitkfdqfdflidivpr