Lineage for d1n1jb_ (1n1j B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211635Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 211636Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 211765Family a.22.1.3: TBP-associated factors, TAFs [47134] (10 proteins)
  6. 211775Protein Nuclear transcription factor Y subunit gamma (Nf-Yc2) [81726] (1 species)
    forms a heterodimer with Nf-Yb3 similar to H2A/H2B
  7. 211776Species Human (Homo sapiens) [TaxId:9606] [81727] (1 PDB entry)
  8. 211777Domain d1n1jb_: 1n1j B: [79814]
    Other proteins in same PDB: d1n1ja_

Details for d1n1jb_

PDB Entry: 1n1j (more details), 1.67 Å

PDB Description: crystal structure of the nf-yb/nf-yc histone pair

SCOP Domain Sequences for d1n1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens)}
lplarikkimkldedvkmisaeapvlfakaaqifiteltlrawihtednkrrtlqrndia
maitkfdqfdflidivpr

SCOP Domain Coordinates for d1n1jb_:

Click to download the PDB-style file with coordinates for d1n1jb_.
(The format of our PDB-style files is described here.)

Timeline for d1n1jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n1ja_