Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeo-prospero domain of Prospero protein [81681] (1 species) single domain composed of a homeodomain-homology N-terminal region (1245-1295) and the prospero-specific C-terminal region (1296-1396) that forms a 4-helical bundle |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81682] (2 PDB entries) |
Domain d1mija_: 1mij A: [79150] has additional subdomain(s) that are not in the common domain |
PDB Entry: 1mij (more details), 2.05 Å
SCOPe Domain Sequences for d1mija_:
Sequence, based on SEQRES records: (download)
>d1mija_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai qggkdteqswkksiykiisrmddpvpeyfksp
>d1mija_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks iykiisrmddpvpeyfksp
Timeline for d1mija_: