SCOPe 2.08: Domain d1mija_: 1mij A:

Lineage for d1mija_ (1mij A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Homeo-prospero domain of Prospero protein [81681] (1 species)
   single domain composed of a homeodomain-homology N-terminal region (1245-1295) and the prospero-specific C-terminal region (1296-1396) that forms a 4-helical bundle

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81682] (2 PDB entries)

8. Domain d1mija_: 1mij A: [79150]
   has additional subdomain(s) that are not in the common domain

Details for d1mija_

PDB Entry: 1mij, 2.05 Å

PDB Description: Crystal Structure of the Homeo-prospero Domain of D. melanogaster Prospero

PDB Compounds: (A:) Protein prospero

SCOPe Domain Sequences for d1mija_:

Sequence, based on SEQRES records:

>d1mija_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai
qggkdteqswkksiykiisrmddpvpeyfksp

Sequence, based on observed residues (ATOM records):

>d1mija_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks
iykiisrmddpvpeyfksp

Timeline for d1mija_:

• d1mija_ first appeared in SCOP 1.63
  
• d1mija_ appears in SCOPe 2.07