Lineage for d1mija_ (1mij A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210248Family a.4.1.1: Homeodomain [46690] (21 proteins)
  6. 210285Protein Homeo-prospero domain of Prospero protein [81681] (1 species)
    single domain composed of a homeodomain-homology N-terminal region (1245-1295) and the prospero-specific C-terminal region (1296-1396) that forms a 4-helical bundle
  7. 210286Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81682] (1 PDB entry)
  8. 210287Domain d1mija_: 1mij A: [79150]
    complexed with mse

Details for d1mija_

PDB Entry: 1mij (more details), 2.05 Å

PDB Description: Crystal Structure of the Homeo-prospero Domain of D. melanogaster Prospero

SCOP Domain Sequences for d1mija_:

Sequence, based on SEQRES records: (download)

>d1mija_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster)}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai
qggkdteqswkksiykiisrmddpvpeyfksp

Sequence, based on observed residues (ATOM records): (download)

>d1mija_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster)}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks
iykiisrmddpvpeyfksp

SCOP Domain Coordinates for d1mija_:

Click to download the PDB-style file with coordinates for d1mija_.
(The format of our PDB-style files is described here.)

Timeline for d1mija_: