Lineage for d1mdud_ (1mdu D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210163Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2210164Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2210181Species Human (Homo sapiens) [TaxId:9606] [55761] (39 PDB entries)
    Uniprot P20065 55-179
  8. 2210216Domain d1mdud_: 1mdu D: [79017]
    Other proteins in same PDB: d1mdub1, d1mdub2, d1mdue1, d1mdue2
    domain 1
    complexed with atp, ca, trs

Details for d1mdud_

PDB Entry: 1mdu (more details), 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)
PDB Compounds: (D:) gelsolin precursor

SCOPe Domain Sequences for d1mdud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdud_ d.109.1.1 (D:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

SCOPe Domain Coordinates for d1mdud_:

Click to download the PDB-style file with coordinates for d1mdud_.
(The format of our PDB-style files is described here.)

Timeline for d1mdud_: