SCOPe 2.06: Domain d1mdua_: 1mdu A:

Lineage for d1mdua_ (1mdu A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (39 PDB entries)
   Uniprot P20065 55-179

8. Domain d1mdua_: 1mdu A: [79014]
   Other proteins in same PDB: d1mdub1, d1mdub2, d1mdue1, d1mdue2
   domain 1
   complexed with atp, ca, trs

Details for d1mdua_

PDB Entry: 1mdu, 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)

PDB Compounds: (A:) gelsolin precursor

SCOPe Domain Sequences for d1mdua_:

Sequence; same for both SEQRES and ATOM records:

>d1mdua_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asgf

Timeline for d1mdua_:

• d1mdua_ first appeared in SCOP 1.63
  
• d1mdua_ appears in SCOPe 2.05
  
• d1mdua_ appears in SCOPe 2.07
  
• d1mdua_ appears in the current release, SCOPe 2.08