SCOPe 2.06: Domain d1mdub1: 1mdu B:7-146

Lineage for d1mdub1 (1mdu B:7-146)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (8 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [82437] (1 PDB entry)
   sequence identical to the rabbit actin

8. Domain d1mdub1: 1mdu B:7-146 [79015]
   Other proteins in same PDB: d1mdua_, d1mdud_
   complexed with atp, ca, trs

Details for d1mdub1

PDB Entry: 1mdu, 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)

PDB Compounds: (B:) a-actin

SCOPe Domain Sequences for d1mdub1:

Sequence, based on SEQRES records:

>d1mdub1 c.55.1.1 (B:7-146) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslya

Sequence, based on observed residues (ATOM records):

>d1mdub1 c.55.1.1 (B:7-146) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprgqkdsyvgdeaqskrgiltlkypie
hgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpam
yvaiqavlslya

Timeline for d1mdub1:

• d1mdub1 first appeared in SCOP 1.63
  
• d1mdub1 appears in SCOPe 2.05
  
• d1mdub1 appears in SCOPe 2.07
  
• d1mdub1 appears in the current release, SCOPe 2.08