![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin [53073] (8 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [82437] (1 PDB entry) sequence identical to the rabbit actin |
![]() | Domain d1mdub2: 1mdu B:147-375 [79016] Other proteins in same PDB: d1mdua_, d1mdud_ complexed with atp, ca, trs |
PDB Entry: 1mdu (more details), 2.2 Å
SCOPe Domain Sequences for d1mdub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdub2 c.55.1.1 (B:147-375) Actin {Chicken (Gallus gallus) [TaxId: 9031]} sgrttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvtta ereivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqp sfigmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapst mkikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrk
Timeline for d1mdub2:
![]() Domains from other chains: (mouse over for more information) d1mdua_, d1mdud_, d1mdue1, d1mdue2 |