![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (6 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.4: Hypothetical protein TM0936 [82224] (1 protein) |
![]() | Protein Hypothetical protein TM0936 [82225] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [82226] (1 PDB entry) |
![]() | Domain d1j6pa1: 1j6p A:-1-49,A:331-405 [77089] Other proteins in same PDB: d1j6pa2 structural genomics protein; complexed with mse, ni |
PDB Entry: 1j6p (more details), 1.9 Å
SCOP Domain Sequences for d1j6pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6pa1 b.92.1.4 (A:-1-49,A:331-405) Hypothetical protein TM0936 {Thermotoga maritima} hhmiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwna dlvvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelar iekelys
Timeline for d1j6pa1: