PDB entry 1j6p

View 1j6p on RCSB PDB site
Description: crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution
Deposited on 2002-07-09, released 2002-10-30
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j6pA (A:)
    hhmiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpalfnththa
    pmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgiagfvdmyfhe
    ewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvgfgphspylc
    seeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahcvhlperyfg
    vlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnlffemrlasl
    lqkaqnprnldvntclkmvtydgaqamgfksgkieegwnadlvvidldlpemfpvqnikn
    hlvhafsgevfatmvagkwiyfdgeyptidseevkrelariekelys