SCOP 1.65: Domain d1j6pa1: 1j6p A:-1-49,A:331-405

Lineage for d1j6pa1 (1j6p A:-1-49,A:331-405)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.4: Hypothetical protein TM0936 [82224] (1 protein)

6. Protein Hypothetical protein TM0936 [82225] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [82226] (2 PDB entries)

8. Domain d1j6pa1: 1j6p A:-1-49,A:331-405 [77089]
   Other proteins in same PDB: d1j6pa2
   structural genomics
   complexed with mse, ni

Details for d1j6pa1

PDB Entry: 1j6p, 1.9 Å

PDB Description: crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution

SCOP Domain Sequences for d1j6pa1:

Sequence; same for both SEQRES and ATOM records:

>d1j6pa1 b.92.1.4 (A:-1-49,A:331-405) Hypothetical protein TM0936 {Thermotoga maritima}
hhmiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwna
dlvvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelar
iekelys

Timeline for d1j6pa1:

• d1j6pa1 first appeared in SCOP 1.63
  
• d1j6pa1 appears in SCOP 1.67
  
• d1j6pa1 appears in the current release, SCOPe 2.07