SCOP 1.63: Domain d1j6pa2: 1j6p A:50-330

Lineage for d1j6pa2 (1j6p A:50-330)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (12 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.9: Hypothetical protein TM0936, probable catalytic domain [82258] (1 protein)

6. Protein Hypothetical protein TM0936, probable catalytic domain [82259] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [82260] (1 PDB entry)

8. Domain d1j6pa2: 1j6p A:50-330 [77090]
   Other proteins in same PDB: d1j6pa1
   structural genomics protein; complexed with mse, ni

Details for d1j6pa2

PDB Entry: 1j6p, 1.9 Å

PDB Description: crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution

PDB Compounds: (A:)

SCOP Domain Sequences for d1j6pa2:

Sequence; same for both SEQRES and ATOM records:

>d1j6pa2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima}
alfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgia
gfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvg
fgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahc
vhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnl
ffemrlasllqkaqnprnldvntclkmvtydgaqamgfksg

Timeline for d1j6pa2:

• d1j6pa2 appears in SCOP 1.65
  
• d1j6pa2 appears in the current release, SCOPe 2.07