Lineage for d2bpga3 (2bpg A:92-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716399Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2716400Protein DNA polymerase beta [81579] (2 species)
  7. 2716547Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)
  8. 2716574Domain d2bpga3: 2bpg A:92-148 [75993]
    Other proteins in same PDB: d2bpga1, d2bpga4, d2bpgb1, d2bpgb4
    protein/DNA complex; complexed with dct, mg

Details for d2bpga3

PDB Entry: 2bpg (more details), 3.6 Å

PDB Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d2bpga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpga3 a.60.12.1 (A:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOPe Domain Coordinates for d2bpga3:

Click to download the PDB-style file with coordinates for d2bpga3.
(The format of our PDB-style files is described here.)

Timeline for d2bpga3: