Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries) |
Domain d2bpgb1: 2bpg B:9-91 [18075] Other proteins in same PDB: d2bpga3, d2bpga4, d2bpgb3, d2bpgb4 protein/DNA complex; complexed with dct, mg |
PDB Entry: 2bpg (more details), 3.6 Å
SCOPe Domain Sequences for d2bpgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpgb1 a.60.6.1 (B:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk iaekideflatgklrklekirqd
Timeline for d2bpgb1: